PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017640m
Common NameCARUB_v10017640mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 326aa    MW: 36205.2 Da    PI: 7.5848
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017640mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Carubv10017640m 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Carubv10017640m  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.078961IPR017930Myb domain
SuperFamilySSF466891.95E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002495.6E-161461IPR001005SANT/Myb domain
CDDcd001671.07E-101661No hitNo description
PROSITE profilePS5129423.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1467112IPR001005SANT/Myb domain
CDDcd001673.01E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKVN  120
QDSHQELDHS SLSSSPSSSS ANSNSNISRG QWERRLQTDI HLAKKALSEA LSPAVAPIIT  180
HTATTTTTTS SSAESRRSTS SASGFLRTQE TSTTYASSTE NIAKLLKGWV KNSPKTHNSA  240
DQITCIDSEV KEVIKSDDVK GLESTFSEFD QSSYQQAGVS PDHETKPDIT GCSNQSQWSL  300
FEKWLFEDSG GQIGDILLDE NTNFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0072890.0AJ007289.1 Arabidopsis thaliana mRNA for myb-like protein.
GenBankAY0812780.0AY081278.1 Arabidopsis thaliana MYB family transcription factor, putative (At3g28910) mRNA, complete cds.
GenBankAY1145600.0AY114560.1 Arabidopsis thaliana MYB family transcription factor (At3g28910) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291492.10.0hypothetical protein CARUB_v10017640mg
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLR0HGT50.0R0HGT5_9BRAS; Uncharacterized protein
STRINGAT3G28910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.10.0myb domain protein 30